PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48543.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 304aa    MW: 34929.1 Da    PI: 6.9424
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48543.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.9e-072972447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     WT eE++ ++ + +    + Wk I+ +    +t+ q+ s+ qky
       KHN48543.1 29 WTIEEHKSFLFGLEIKKEKGWKQISDKYVPSKTASQVASHAQKY 72
                     *************************99988*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.0272177IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-52376IPR009057Homeodomain-like
SuperFamilySSF466891.01E-112376IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-92475IPR006447Myb domain, plants
CDDcd001676.20E-42973No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MVLASQDPCH VILSGDSSHS VHHKKYEHWT IEEHKSFLFG LEIKKEKGWK QISDKYVPSK  60
TASQVASHAQ KYVKRKNTPM KERKRRSIHD TILEDIDLIR IDQHNWVPPT SNFIVQPHTL  120
GSNWVPSTSN LMVQSHSPVT DQHNWIPPCA PNFAVPPLPQ CIPHVDQDNW VSPPSNLAAQ  180
SCTAHIDQYT WDPPPPNFAV QPPTPHIDQH NWVPSPPNFA PHTSLIDQDN WVPTPPDFAV  240
QPHEMQRAHH MQMQQLNLHS SSPQMDEYRN FNSGHPQNEL DLIAQQILEY KNKFNHKDNE  300
GSTR
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN48543.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601664.11e-167myb-like protein J
TrEMBLA0A0B2SUC50.0A0A0B2SUC5_GLYSO; Myb-like protein J
STRINGGLYMA08G45255.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2672723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-15MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]