PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 218aa    MW: 24011.6 Da    PI: 9.2449
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48386.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.6e-42421411100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael++++ 
  KHN48386.1  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPECQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAELNAVRG 140
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  KHN48386.1 141 E 141
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6941142IPR004883Lateral organ boundaries, LOB
PfamPF031959.6E-4242138IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRERD VSSQMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PECQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQQQVQS LQAELNAVRG EILKYKLREA NMIPSSHHVG MLPSSGAVSI AAPPPPPPPP  180
PPPSLPLPLT SPSSSIYIQH RDPTTYTTIS SDNISYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-46341563125LOB family transfactor Ramosa2.1
5ly0_B2e-46341563125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN48386.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-119AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526822.11e-139LOB domain-containing protein 15
RefseqXP_028236339.11e-139LOB domain-containing protein 15-like
SwissprotQ8L5T55e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0B2SP341e-159A0A0B2SP34_GLYSO; LOB domain-containing protein 15
STRINGGLYMA06G15050.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-84LOB domain-containing protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]