PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 308aa    MW: 35499.7 Da    PI: 5.8442
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48375.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS40.64e-13129205380
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80 
                 + Lle A+av+++++++ q+l++ l++l+sp++d+ q+la+yf++   +++++ ++++yk+l++ ++++  s ++++ 
  KHN48375.1 129 DILLETARAVADKNTTRLQQLMWMLNKLSSPYDDTDQKLASYFLQTFFSHITQAGDRTYKTLASASKKT-CSFKSTHK 205
                 689**********************************************************98777763.33334444 PP

2GRAS30.16.2e-10230296241308
        GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
                  ++ ++ +++ +F+++f e+l+++ + f++l+  +pr+s+e  ++Ere  gr+ v++vac+  e++er
  KHN48375.1 230 EADLDIGLEGFEFVKGFEECLRWFRVYFEALDRIFPRTSNEHLMLERE-AGRAMVDLVACSLVESVER 296
                 444455566779************************************.************9998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035141.4E-10129205IPR005202Transcription factor GRAS
PfamPF035142.1E-7230296IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDTTLFRVVS SFQHHQADQD HQSLNNSTTS SSSRSSRQEQ NYPYPQEDDE ECFNFFMDEE  60
DLSSSSSRHY YPYQPHPPST TGIDTAFPFE FMKEIRATVQ KVMKEIKARN HSFSPTPCDF  120
EFSGKWAQDI LLETARAVAD KNTTRLQQLM WMLNKLSSPY DDTDQKLASY FLQTFFSHIT  180
QAGDRTYKTL ASASKKTCSF KSTHKTCSFV TAATTAQKVM KEIKARMEKE ADLDIGLEGF  240
EFVKGFEECL RWFRVYFEAL DRIFPRTSNE HLMLEREAGR AMVDLVACSL VESVERWGVW  300
VFYGSTGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353061e-124AC235306.1 Glycine max strain Williams 82 clone GM_WBb0068C17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538789.16e-94PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF78e-35SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A0B2SU340.0A0A0B2SU34_GLYSO; Protein SHORT-ROOT
STRINGGLYMA11G23690.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3597922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.13e-35GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]