PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family VOZ
Protein Properties Length: 459aa    MW: 51163.1 Da    PI: 6.1453
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48176.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ436.34e-1341934101217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                 pppsaflgpkcalwdc+rp+qg +w+qdycssfha+lalneg+pg+tpvlrp+gi+lkd+llfaalsak+qgk vgipecegaatakspwna+elfd++
  KHN48176.1 193 PPPSAFLGPKCALWDCPRPVQGLDWCQDYCSSFHAALALNEGPPGMTPVLRPGGIGLKDNLLFAALSAKAQGKVVGIPECEGAATAKSPWNAPELFDIC 291
                 89************************************************************************************************* PP

         VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakg 198
                 +legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp++ fewhlyeyei+++d +alyrlelklvd+kks+k+
  KHN48176.1 292 VLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNLFEWHLYEYEISKCDVCALYRLELKLVDGKKSSKA 390
                 *************************************************************************************************** PP

         VOZ 199 k.vskdsladlqkklgrlta 217
                 k v+ ds+adlqk++g+l+a
  KHN48176.1 391 KiVTGDSVADLQKHMGSLSA 410
                 *5578************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MKKISKSSCK LASHRLFKDK ARNHVDDLQV MFLDLQFARK ESRTIDAALL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDVYRL LQLCEEEDDA TSPLVAPKPE PNDQIMQAGA  120
KVIVQEGQHQ QELLLLKECK PFTVGFPNLD GTALEYHQFD INKDMDDSFY AGTGFCEEGR  180
VPHISSYLPS VCPPPSAFLG PKCALWDCPR PVQGLDWCQD YCSSFHAALA LNEGPPGMTP  240
VLRPGGIGLK DNLLFAALSA KAQGKVVGIP ECEGAATAKS PWNAPELFDI CVLEGETIRE  300
WLFFDKPRRA FESGNRKQRS LPDYSGRGWH ESRKQVMNEF GGLKRSYYMD PQPLNLFEWH  360
LYEYEISKCD VCALYRLELK LVDGKKSSKA KIVTGDSVAD LQKHMGSLSA KGSRTKLGIG  420
GGVYSASNRV ALLNAPYQYG LTSPYDDYVV HNTLDYYVT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN48176.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-157AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594201.10.0transcription factor VOZ1 isoform X1
RefseqXP_028195785.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0R0HKC70.0A0A0R0HKC7_SOYBN; Uncharacterized protein
TrEMBLA0A445HGN10.0A0A445HGN1_GLYSO; Transcription factor VOZ1 isoform A
STRINGXP_007148099.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]