PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47586.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 264aa    MW: 29421.6 Da    PI: 8.7823
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47586.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.7e-4197174178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v g+eqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  KHN47586.1  97 RCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVVVLGMEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSH 174
                 6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-3594159IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.34295172IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-3996177IPR004333Transcription factor, SBP-box
PfamPF031103.0E-3298171IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MEFGGNMFRL GNRDQNGNTN NNGNAFAWDS WENPTNSNNN NNNNNNSSRL VNAFHIPIAS  60
GIPSMDDGSV HVIRHETAGL ASAGVKAAGF AAVTVPRCQV EGCHVALLNA KDYHRRHKVC  120
EMHSKAPKVV VLGMEQRFCQ QCSRFHVVSE FDDSKRSCRR RLAGHNERRR KSSHDSVARN  180
SSQGGCALSL LSSRSDSWLS PSDLSTRCSA ALRELIAENR AAIMARQFVS DRSHLHSHHH  240
AVEDLKDIQP ESNYFPQQMY PQTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30981711184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN47586.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-69AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513942.11e-110squamosa promoter-binding-like protein 7
RefseqXP_025983401.11e-111squamosa promoter-binding-like protein 7
SwissprotQ7XT426e-55SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0B2SLL70.0A0A0B2SLL7_GLYSO; Squamosa promoter-binding-like protein 7
STRINGGLYMA11G16556.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-36squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]