PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 311aa    MW: 34311.8 Da    PI: 8.167
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47559.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18163217256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq   Lee F+++++++ ++++ L+k+l+L  rqV vWFqNrRa+ k
  KHN47559.1 163 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALSKQLNLRPRQVEVWFQNRRARTK 217
                 788899***********************************************98 PP

2HD-ZIP_I/II1231.5e-39163252191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLEesF+++++L+p++K++l+++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
   KHN47559.1 163 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALSKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 252
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.248159219IPR001356Homeobox domain
SMARTSM003891.2E-15161223IPR001356Homeobox domain
SuperFamilySSF466896.84E-18162227IPR009057Homeodomain-like
CDDcd000869.35E-17163220No hitNo description
Gene3DG3DSA:1.10.10.602.6E-17163217IPR009057Homeodomain-like
PfamPF000467.4E-16163217IPR001356Homeobox domain
PROSITE patternPS000270194217IPR017970Homeobox, conserved site
PfamPF021836.2E-10219253IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-25219262IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMGLDQDASS NSGLQLILGL ALTATTTTTP SSPPSISNKL DHVDHHHHLI TLRPTTKSSY  60
NSSEAEPSLT LGLSRESYLK VPKSIIGHNN NKVSSCDDPL DLSTQTNSPH HSAVSSFSSG  120
RVKRERDLSC EEVVDAKEID QRDLSCEGII RATEEEEDGA ATRKKLRLTK EQSALLEESF  180
KQHSTLNPKQ KQALSKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR  240
RLQKELQELK ALKLAQPLYM PMPAATLAMC PSCERLGGSA VNGAGGSPKT SFSMAPKPHF  300
FNPFANPSAA C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161167TRKKLRL
2211219RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN47559.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311730.0KT031173.1 Glycine max clone HN_CCL_18 homeodomain/HOMEOBOX transcription factor (Glyma17g16930.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028232238.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-88HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0B2SSQ10.0A0A0B2SSQ1_GLYSO; Homeobox-leucine zipper protein HAT22
STRINGGLYMA05G23150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-75HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]