PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47241.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YC
Protein Properties Length: 112aa    MW: 12694.8 Da    PI: 4.493
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47241.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC734.4e-235673799
       NF-YC 37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
                +mis+e+P+l+skace+fi elt+r+w+hae+n+++ ++ +d+a+++ +td+ +fl++i+p++
  KHN47241.1  5 QMISSEIPMLMSKACEIFIQELTFRAWMHAEKNNKSIVQPCDVAKVIMQTDTMNFLTEIIPNN 67
                79**********************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.1E-7550IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.97E-17566IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.2E-18565IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MFTKQMISSE IPMLMSKACE IFIQELTFRA WMHAEKNNKS IVQPCDVAKV IMQTDTMNFL  60
TEIIPNNLGD FSVFDAKEEN IANIAEENEV SLSFTAGFMG NPMMKMDSVS KK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_C9e-1756658119HapE
4g91_C9e-1756658119HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497574.12e-40PREDICTED: nuclear transcription factor Y subunit C-3-like isoform X2
TrEMBLA0A0B2SKS08e-78A0A0B2SKS0_GLYSO; Nuclear transcription factor Y subunit C-3
TrEMBLK7K7918e-78K7K791_SOYBN; Uncharacterized protein
STRINGGLYMA02G09867.12e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1821366
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.11e-19nuclear factor Y, subunit C1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]