PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN47210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family VOZ
Protein Properties Length: 478aa    MW: 53316.8 Da    PI: 6.001
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN47210.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4459.1e-1372014171217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                 pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkd+llfaalsak+qgk+vgipecegaatakspwna+elfdls
  KHN47210.1 201 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMAPVLRPGGIGLKDNLLFAALSAKAQGKDVGIPECEGAATAKSPWNAPELFDLS 299
                 89************************************************************************************************* PP

         VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakg 198
                 +legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei+++da+alyrlelklvd+kk++k+
  KHN47210.1 300 VLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEISKCDACALYRLELKLVDGKKNSKT 398
                 *************************************************************************************************** PP

         VOZ 199 kvskdsladlqkklgrlta 217
                 k ++ds+adlqk++grl+a
  KHN47210.1 399 KAANDSVADLQKQMGRLSA 417
                 *****************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MKKVPKNSCK SASHRLFKDK AKNRVDDLQL MFLDLQFARK ESRTVDAAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDICRL LQLCEEEDDA SSQLAAPKPE PNDQTLQVGG  120
KVMFQEGQQQ HDFPFVDECK HFTSSVQNVA ANNPDGHDLE YHQFDLHQDY DHGLYTGFNG  180
TGYCEEDAIP HISSYLPSIC PPPSAFLGPK CALWDCPRPA QGLDWCQDYC SSFHAALALN  240
EGPPGMAPVL RPGGIGLKDN LLFAALSAKA QGKDVGIPEC EGAATAKSPW NAPELFDLSV  300
LEGETIREWL FFDKPRRAFE SGNRKQRSLP DYSGRGWHES RKQVMNEFGG LKRSYYMDPQ  360
PLNHFEWHLY EYEISKCDAC ALYRLELKLV DGKKNSKTKA ANDSVADLQK QMGRLSAEFP  420
HDNKRAAKGR AKINTKVGIG GGVYSASHRV TPLNGTYEYG LAAPYDYLVD NMGDYYGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN47210.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660920.0AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594297.10.0transcription factor VOZ1
RefseqXP_028188939.10.0transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A445I6670.0A0A445I667_GLYSO; Transcription factor VOZ1 isoform A
TrEMBLI1M0500.0I1M050_SOYBN; Uncharacterized protein
STRINGGLYMA13G24170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]