PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 591aa    MW: 65770.5 Da    PI: 7.2333
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46870.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.7e-29368419152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  KHN46870.1 368 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 419
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291358439IPR003035RWP-RK domain
PfamPF020422.6E-24372419IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22477568No hitNo description
Gene3DG3DSA:3.10.20.2409.7E-22480563No hitNo description
PROSITE profilePS5174521.936481566IPR000270PB1 domain
SMARTSM006661.0E-23481566IPR000270PB1 domain
CDDcd064072.35E-39482565No hitNo description
PfamPF005644.9E-14482565IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MPMGKTWWIG PKANHASVKE RLEAAMGYLR EYTNNNIQIW VPLRRSAGQE LGTDESDTIA  60
FERNRNVKLR LFRSQEGCVG VPVLERGSGT CLGVLEIVME DEVVSEMMEV VRCVCKAQKV  120
PLALAWAPCV QQKQAKYCGH SRDESYVSTV ERACFVGEEN PQLLGFQEAC SQHHLFRGQG  180
VVGTALATAK PCFATDITAF SNAEYPLSHH ASIFDLHAAV AIPLTTFSSS FHFVLEFFLP  240
LDCPDHNHFL NSLSLLLHQA CRSTFHLSLI HDHHLDFEFL PTESPSQASW IAHMMEAQSQ  300
HIKGVCLSLE EEPKEEFKVT TTHYCNWDST ATSTYQAHDQ VVFGEESHTH TFGGKRGRKP  360
GEKRRTKAEK TISLPVLRQY FAGSLKDAAK SIGVCPTTLK RICRQHGITR WPSRKIKKVG  420
HSLKKLQLVI DSVQGAEGAI QIGSFYNSFP ELSSQSSKSN NNNNSSSPTA AAAAAQSPQQ  480
PLRVKATFAD EKIRFSLQPH WGFTELQLEI ARRFNLNDVS NGYLVLKYLD DDGEWVVLAC  540
DGDLEECKDL HTTSQSRTIR LALFQASPLN NLPNTYTFAA ATPSSSLAVS L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2390417e-95AJ239041.1 Lotus corniculatus var. japonicus mRNA for nodule inception protein (nin).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596576.10.0PREDICTED: protein NLP2
TrEMBLA0A0B2SPM90.0A0A0B2SPM9_GLYSO; Protein NLP5
STRINGGLYMA14G00470.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.15e-86Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]