PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 297aa    MW: 33385.3 Da    PI: 6.0464
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46452.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS273.75.9e-841229773374
        GRAS  73 nsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAe 170
                 + +e + ++k++++++P+ kf+hltaNqaIlea+e+++ +Hi+Df+i qG+QW+aLlqa+a+R++g+p ++ i g+ +              rL++fA+
  KHN46452.1  12 SWEELTLSYKALNDACPYSKFAHLTANQAILEATENASNIHILDFGIVQGIQWAALLQAFATRASGKPnKITISGIPA--------------RLSDFAR 96 
                 466778899*******************************************************77776999999999..............******* PP

        GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                  l+++f f++ + + +++l+ +++ ++p+E+laVn++lql++llde+ +  +   + L+l ksl+P++v++ e ea+ ++  F++rf  a++y+sa+f+
  KHN46452.1  97 LLDLNFVFTP-ILTPIHQLDHNSFCIDPNEVLAVNFMLQLYNLLDEPPTAVD---TALRLAKSLNPRIVTLGEYEASVTRVGFVNRFRTAFKYFSAVFE 191
                 **********.799******************************99999888...******************************************** PP

        GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee..sgslvlgWkdr 365
                 sle +l+++s er  vE  llgr+i  v+     +  e +e +e+Wr  +e+aGF++v+ls++a +qak ll +++ s  +++ e+   g l l Wkd 
  KHN46452.1 192 SLEPNLAADSPERFQVESLLLGRRIAAVIGPGPVR--ESMEDKEQWRVLMERAGFESVSLSHYAISQAKILLWNYSySSLFSLVESkpPGFLSLAWKDV 288
                 *****************************999887..9**************************************9999*999873345566****** PP

        GRAS 366 pLvsvSaWr 374
                 pL++vS+Wr
  KHN46452.1 289 PLLTVSSWR 297
                 ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.4881274IPR005202Transcription factor GRAS
PfamPF035142.0E-8112297IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MWGDKEKMEP RSWEELTLSY KALNDACPYS KFAHLTANQA ILEATENASN IHILDFGIVQ  60
GIQWAALLQA FATRASGKPN KITISGIPAR LSDFARLLDL NFVFTPILTP IHQLDHNSFC  120
IDPNEVLAVN FMLQLYNLLD EPPTAVDTAL RLAKSLNPRI VTLGEYEASV TRVGFVNRFR  180
TAFKYFSAVF ESLEPNLAAD SPERFQVESL LLGRRIAAVI GPGPVRESME DKEQWRVLME  240
RAGFESVSLS HYAISQAKIL LWNYSYSSLF SLVESKPPGF LSLAWKDVPL LTVSSWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1141429774375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540145.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL031e-147SCL4_ARATH; Scarecrow-like protein 4
TrEMBLA0A0B2SQC60.0A0A0B2SQC6_GLYSO; Scarecrow-like protein 4
STRINGGLYMA12G02060.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-148GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]