PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 53aa    MW: 5965.07 Da    PI: 7.4173
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46125.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26036.81.1e-113392864
      DUF260 28 kkfanvhklFGasnvlkllkalpeeeredamsslvye 64
                +kfa+vhk+FG snv+k+lk+lp ++reda+sslv e
  KHN46125.1  3 SKFAIVHKVFGCSNVTKMLKDLPVHQREDAVSSLVQE 39
                58********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.758153IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-11339IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MISKFAIVHK VFGCSNVTKM LKDLPVHQRE DAVSSLVQEL QTPCMVVLES YLT
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN46125.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-15LBD family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]