PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 108aa    MW: 12356.3 Da    PI: 7.3014
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44818.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.21.5e-341093185
      DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85
                +C aCk+lr+ C  dC+++pyfp ++p+kfan+hk+FGa nv+kl +++++ +reda++sl+yeAea+++dPvyG+vg i+ l +
  KHN44818.1 10 PCDACKFLRK-CMMDCIFSPYFPPKEPQKFANMHKIFGACNVSKLQNEVQPYQREDAVNSLAYEAEAWIEDPVYGCVGAISVLLK 93
                7*******98.********************************************************************987643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.7979108IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-331093IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MASSSYSNSP CDACKFLRKC MMDCIFSPYF PPKEPQKFAN MHKIFGACNV SKLQNEVQPY  60
QREDAVNSLA YEAEAWIEDP VYGCVGAISV LLKVQILHQH RERTFVQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-43391493LOB family transfactor Ramosa2.1
5ly0_B1e-43391493LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN44818.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0908391e-110BT090839.1 Soybean clone JCVI-FLGm-5B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516425.12e-77LOB domain-containing protein 25
RefseqXP_028199107.12e-77LOB domain-containing protein 25-like
SwissprotQ8L8Q31e-47LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0B2SJ103e-76A0A0B2SJ10_GLYSO; LOB domain-containing protein 25
TrEMBLA0A445M2D58e-76A0A445M2D5_GLYSO; LOB domain-containing protein 25
TrEMBLI1J7M53e-76I1J7M5_SOYBN; Uncharacterized protein
STRINGGLYMA01G32340.16e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3501322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-50LOB domain-containing protein 25
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]