PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 232aa    MW: 27739.6 Da    PI: 8.0607
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44708.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.21.6e-212721386
    trihelix 13 arremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                +r e+++++ ++k++k+lWe +s +m+e+gf++s++qCk+kw+nl +ryk ++++e +    +++++p++++l+
  KHN44708.1  2 IRAELDQTFMDTKRNKQLWEVISTRMKEKGFHKSAEQCKCKWKNLVTRYKGCETMEPEA---TRQQFPFYNELQ 72
                7999*****************************************************96...45679*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.20E-16154No hitNo description
PfamPF138371.0E-16674No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MIRAELDQTF MDTKRNKQLW EVISTRMKEK GFHKSAEQCK CKWKNLVTRY KGCETMEPEA  60
TRQQFPFYNE LQAIFAARMQ RMLWAEAEGG SNKKKVHLSS EDEEEGNEET SEGDHKGNIT  120
SKKKKKGKMV IGGGGSGNNN LESLKEIMDE FMRQQMQMEA QWMEAFEARE NERRLKEMEW  180
RQTMEALENE RLMMDQRWRE REEQRRIREE VRADKRDALI TALLNKLRRE EM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-144AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583658.11e-170PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW09e-62TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLI1KKF81e-170I1KKF8_SOYBN; Uncharacterized protein
STRINGGLYMA07G18320.11e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.15e-46Trihelix family protein