PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 648aa    MW: 73256.3 Da    PI: 9.0407
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44613.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-16242283346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd++l  av ++G   W++Ia++++  Rt+ qc+ rw  
       KHN44613.1 242 GWTEEEDLRLEAAVVKHGYC-WSKIAEEVP-PRTDSQCRKRWKV 283
                      5*****************99.*********.9**********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.8E-17228286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-17231284IPR009057Homeodomain-like
PROSITE profilePS5129422.53235289IPR017930Myb domain
SMARTSM007172.6E-13239287IPR001005SANT/Myb domain
PfamPF002492.8E-14242283IPR001005SANT/Myb domain
CDDcd001673.53E-13243284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MEMLVEGDQT SSPGYEGDIA NDSIYYESDV GELCPVSQHT NEAATKELIQ NVEMKLSDFV  60
ESSEPDACGS SKLPQKRLSC PPVVRFFIDA INKNRDLQRF IRSKLIEFEA KIEENKKMRN  120
KIKILKDFQA SCTRRTGNVL SLKKDPRVQL ISSKKSFAPK NSKKPKKASA MCYGPEENSH  180
VANYRMVLER FPLSLDRKKW SNVERESLLK GIKQQFQEMV LQLSLSVDRY LNCLDPSLKW  240
GGWTEEEDLR LEAAVVKHGY CWSKIAEEVP PRTDSQCRKR WKVLCPEYVP LLQEARKKQR  300
SIIGCNFVDR ESERPAITLN DFLPLPVPAP KSDVGASNLR KKAKSSNVPK KMSKKLAKRA  360
RLHTKEVQDT EVYSDDGIKT YGEVSACSNV PKKMRSKRHT KKTRNCPKEV VDIYCSEKVK  420
TCIESSESQS TCIASSGNQD SDNITIACFL RDKSKEMLSR FTKDLSQASF SSRSIDVSNK  480
QVESQDPFDD QIGLSKSFDT VGTENLFVQQ NVASDRRVGK PEDANTLTGG DHDEMTLACF  540
LGNKSKKGSQ AANGRGACSS TIIIPDDSGL SMSKHVEKET VLHGGVAEPM DIVVEEKDDE  600
LLTSFLQNRP TRQRKRPSRY SEFRVPYAEL GPVYRFSAWR NLYTNRLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1338344LRKKAKS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN44613.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-132AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028239918.10.0uncharacterized protein LOC114418658 isoform X1
TrEMBLA0A0B2SID40.0A0A0B2SID4_GLYSO; Myb-like protein L
STRINGGLYMA07G11330.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.26e-31myb domain protein 4r1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]