PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 596aa    MW: 66484.5 Da    PI: 4.5145
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44267.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.62.5e-1382235932374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL+ecA a+s+g+  + ++++++l++++s +g+p qR+aay++e+Laarla+s++++ykal+++e +   +s++laa+++++ev+P++kf++++aN+
  KHN44267.1 223 RKLLYECAIALSEGNEVEGSSMINNLRQMVSIQGEPSQRIAAYMVEGLAARLAESGKSIYKALRCKEPP---TSDRLAAMQILFEVCPCFKFGFIAANN 318
                 689*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 +I eav+ + ++HiiDfdi+qG Q+++L+q+LasR+++pp++R+Tgv++pes+  s   l+++g+rL+k+Ae+lg+pfef++ va+r++ +++++L+++
  KHN44267.1 319 TITEAVKDDMKIHIIDFDINQGSQYINLIQTLASRSSKPPHVRLTGVDDPESVqrSVGGLQNIGQRLEKLAEALGLPFEFRA-VASRTSIVTPSMLDCS 416
                 ***************************************************9999999************************.7*************** PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 p+Eal+Vn+++qlh+++desvs+++erd++L+lvksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+f+sl+a+lpres++r++vEr++l+r+ivn
  KHN44267.1 417 PDEALVVNFAFQLHHMPDESVSTANERDQLLRLVKSLNPKLVTVVEQDVNTNTTPFLPRFVEAYNYYSAVFESLDATLPRESQDRMNVERQCLARDIVN 515
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vvaceg++r+er e ++kWr+r+++aGF++ p+s++++++++ l++ v+ d y+++ee g+l +gW+d++L+++SaW+
  KHN44267.1 516 VVACEGEDRIERYEVAGKWRARMTMAGFTSSPMSTNVTDEIRQLIKVVYCDRYKIKEEMGALHFGWEDKSLIVASAWK 593
                 *************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.357196573IPR005202Transcription factor GRAS
PfamPF035148.8E-136223593IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MSLVRSADLA PTSYENAKLF SLKGTDVRPG LSSQIFGPDK HRSTYMTDTY PSESYEKYFH  60
DSQTEEIIEP SSSSISGSSI HPDVASSYQI RAISGASMVA NNPFDSSFMS TRHRDAYQSN  120
SGSDLMENGS LDSRNDDGLM RLKLQALERA LLDDSDAEEE EEEEEDIFEA AQSMEIDPDI  180
AEWADSMQNM LLHDSPKETS SSDSNISSIS STKEISQTSQ NPRKLLYECA IALSEGNEVE  240
GSSMINNLRQ MVSIQGEPSQ RIAAYMVEGL AARLAESGKS IYKALRCKEP PTSDRLAAMQ  300
ILFEVCPCFK FGFIAANNTI TEAVKDDMKI HIIDFDINQG SQYINLIQTL ASRSSKPPHV  360
RLTGVDDPES VQRSVGGLQN IGQRLEKLAE ALGLPFEFRA VASRTSIVTP SMLDCSPDEA  420
LVVNFAFQLH HMPDESVSTA NERDQLLRLV KSLNPKLVTV VEQDVNTNTT PFLPRFVEAY  480
NYYSAVFESL DATLPRESQD RMNVERQCLA RDIVNVVACE GEDRIERYEV AGKWRARMTM  540
AGFTSSPMST NVTDEIRQLI KVVYCDRYKI KEEMGALHFG WEDKSLIVAS AWKLPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-5324559326375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630459.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_006578946.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_003523408.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0B2SJ020.0A0A0B2SJ02_GLYSO; Scarecrow-like protein 1
TrEMBLK7KM360.0K7KM36_SOYBN; Uncharacterized protein
STRINGGLYMA04G42090.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]