PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43872.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 545aa    MW: 61468.8 Da    PI: 5.3737
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43872.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS435.54.1e-1331765452374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 +e L +cA+ v+ +d+e +++l+++l++++s +gdp+qRl ay++eAL arla+s+s++yk l+++e +    se l+ ++l++e++P+lkf+++ aN 
  KHN43872.1 176 KEMLCTCAKTVAVNDMETTEWLMSELRKMVSVSGDPIQRLGAYMLEALVARLASSGSTIYKVLKCKEPT---GSELLSHMHLLYEICPYLKFGYMSANG 271
                 789*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 aI ea+++e++vHiiDf+i+qG+QW++L+qaLa Rp+gpp++RiTg+++++s   ++  le +g rL+ +A++ +vpfef++ +  + +++el++L+++
  KHN43872.1 272 AIAEAMKEESEVHIIDFQINQGIQWVSLIQALAGRPGGPPKIRITGFDDSTSAyaREGGLEIVGARLSTLAQSYNVPFEFHA-IRASPTEVELKDLALQ 369
                 *************************************************998899999************************.5888999********* PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 pgEa+aVn++++lh+++desv++ ++rd++++l k lsPk+v++veqe+ +n+ +F+ rf+e+++yy a+f+s+++ lpre++eri+vE+++l+re+vn
  KHN43872.1 370 PGEAIAVNFAMMLHHVPDESVDSGNHRDRLVRLAKCLSPKIVTLVEQESHTNNLPFFPRFVETMNYYLAIFESIDVALPREHKERINVEQHCLAREVVN 468
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 ++aceg+er+erhe l+kWr+r+++aGF p+pl++++++++k l r + ++ y++ee++g+l+lgW+++ L++ +aWr
  KHN43872.1 469 LIACEGEERVERHELLKKWRSRFTMAGFAPYPLNSFITCSIKNLQRSYRGH-YTLEERDGALCLGWMNQVLITSCAWR 545
                 ***********************************************9966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.669149526IPR005202Transcription factor GRAS
PfamPF035141.4E-130176545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MQMSQKHKMS YDSSRFTSEP VQNLGSCCFL QSGNLDYYSS SDNSSHATYP SVCTFEQYCT  60
LESSTNNNLP SLNSSSTVSF SPNNSPVSKL QSKSNVLSSQ NSLELVNDSL ENESCLTLNN  120
DELRHKIREL ESALLGHDTY ILDTYDTIIP EESDSFMLEA ERWKRMMEMI SRGDLKEMLC  180
TCAKTVAVND METTEWLMSE LRKMVSVSGD PIQRLGAYML EALVARLASS GSTIYKVLKC  240
KEPTGSELLS HMHLLYEICP YLKFGYMSAN GAIAEAMKEE SEVHIIDFQI NQGIQWVSLI  300
QALAGRPGGP PKIRITGFDD STSAYAREGG LEIVGARLST LAQSYNVPFE FHAIRASPTE  360
VELKDLALQP GEAIAVNFAM MLHHVPDESV DSGNHRDRLV RLAKCLSPKI VTLVEQESHT  420
NNLPFFPRFV ETMNYYLAIF ESIDVALPRE HKERINVEQH CLAREVVNLI ACEGEERVER  480
HELLKKWRSR FTMAGFAPYP LNSFITCSIK NLQRSYRGHY TLEERDGALC LGWMNQVLIT  540
SCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-601795458375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519619.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A0B2SHR70.0A0A0B2SHR7_GLYSO; Scarecrow-like protein 5
TrEMBLI1JJH10.0I1JJH1_SOYBN; Uncharacterized protein
STRINGGLYMA02G46730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]