PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 412aa    MW: 46022.5 Da    PI: 7.5952
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43662.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32234287255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN43662.1 234 PRMRWTSSLHNRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 287
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.13E-15231288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29232288IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24234287IPR006447Myb domain, plants
PfamPF002493.0E-7235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MPQNKIFHDQ QSSNPIPDLS LHISLPNSAP SSICTEGDSP FDAEGFKSHS DGSIKGCSSP  60
YHTDTQLSLA NPTNTTSTPS EAESTWRKRN FVRLVAEGQI RLINGIPLYS NLSSLDTIPS  120
IERNQPTNKF SFSSLYAFPH PPSAPNYGNN NGVVGGVAVE PISRFREIRT MESSSLRPQQ  180
FQYFDYPHQH QHHHQQQQFG SSNNIGASDF SSNGFVRSRM FSRQQSNKRN MRAPRMRWTS  240
SLHNRFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKN TDKPAASSDG  300
DEDFMSLTVP NDQNNSFLPN QRGTSNASID NDMGYTSSNL WVNSSSSARG ARIQANSRDL  360
DELSPQEILS SQHTGKLSEG SNYIQTRIFN KDQNPSLEFT LGRSNWHNSE HA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-17235289357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17235289357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17235289357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17235289357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17235289458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN43662.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150443e-65AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533311.10.0transcription repressor KAN1 isoform X2
RefseqXP_028248238.10.0transcription repressor KAN1-like isoform X1
TrEMBLA0A0B2SH570.0A0A0B2SH57_GLYSO; Putative transcription factor RL9
TrEMBLK7LEF80.0K7LEF8_SOYBN; Uncharacterized protein
STRINGGLYMA09G30140.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-46G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]