PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 320aa    MW: 34379.3 Da    PI: 8.8147
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43611.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.4e-393796261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +e+ +kcprCds+ntkfCyynnysl+qPr+fCk+CrryWt+GGalrnvP+Ggg+rknk++
  KHN43611.1 37 PEQGVKCPRCDSSNTKFCYYNNYSLTQPRHFCKTCRRYWTNGGALRNVPIGGGCRKNKRA 96
                67899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-273595IPR003851Zinc finger, Dof-type
PfamPF027015.6E-333995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3664195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVPPPENMAT PKDQDATQGR KFTTTTTTTT TTTRPAPEQG VKCPRCDSSN TKFCYYNNYS  60
LTQPRHFCKT CRRYWTNGGA LRNVPIGGGC RKNKRAVVKP SSSSSSSSPR LSTTEFSLRG  120
LNVPPSVEFN LGALPFPASS RLNILEFNLG ALPFPSSLNT NHHIPTIINT GLFNNNQLSP  180
FLDVKSALFQ LDAPPAALSN SLMGIAPNNF WALVTELRQP GLAPEDAAAA LRDNDTTRKP  240
VESLPAGSAV TEGPSGASVT TVAPPTEWFF GNSSFPSTGN GGGNGNNNIN ININDANNNW  300
SDALAWGNFQ QQQQQYSALP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603380.11e-118PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A0B2SA320.0A0A0B2SA32_GLYSO; Dof zinc finger protein DOF5.7
STRINGGLYMA18G26870.21e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-34TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]