PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 831aa    MW: 92801.2 Da    PI: 7.0072
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43557.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B383.61.8e-2679180199
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f k+ltpsd++++g +++pkk+a+e+       +  ++  ++++ +d++g +W +++iyr+k++r++lt+GW+ Fv+a++L +gD+++F   + +++e 
  KHN43557.1  79 FSKILTPSDTSTHGGFSVPKKHADECfppldmtQ--QTPAQEIVAKDLNGFEWHFRHIYRGKPKRHLLTSGWSTFVNAKKLVAGDSCIFV--RAESGEI 173
                 88****************************9643..444569************************************************..459999* PP

                 EEEEE-S CS
          B3  93 vvkvfrk 99 
                 +v+++r+
  KHN43557.1 174 RVGIRRA 180
                 *****97 PP

2Auxin_resp821.3e-27207288183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+s++++F v+Y+P++ + eF+v+++ ++k++   + +GmR++m+ e e+s +r+ +Gt++g +d+d +rWp+S+Wr+Lk
  KHN43557.1 207 ASHAVSSGTMFIVYYHPWTNPFEFIVPLRTYLKSTVPDYPIGMRVQMQHEVEESLRRH-AGTIIGHEDIDKIRWPGSEWRCLK 288
                 789**************************************************99888.9*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-3670209IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-3972190IPR015300DNA-binding pseudobarrel domain
PfamPF023623.2E-2479180IPR003340B3 DNA binding domain
PROSITE profilePS5086313.84679181IPR003340B3 DNA binding domain
SMARTSM010191.0E-2579181IPR003340B3 DNA binding domain
CDDcd100171.45E-2379179No hitNo description
PfamPF065073.3E-27207288IPR010525Auxin response factor
PfamPF023092.1E-5513595IPR033389AUX/IAA domain
PROSITE profilePS5174514.778516598IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MEHVAAYTQH QQDGHMEIPV YDLPSKILCK ILHIELKAEA FSDEVYAQVT LVPALKQDNL  60
RLEVEENDQI PSITTTYTFS KILTPSDTST HGGFSVPKKH ADECFPPLDM TQQTPAQEIV  120
AKDLNGFEWH FRHIYRGKPK RHLLTSGWST FVNAKKLVAG DSCIFVRAES GEIRVGIRRA  180
TEHLSNVSQS SSLISGHSMQ LGILASASHA VSSGTMFIVY YHPWTNPFEF IVPLRTYLKS  240
TVPDYPIGMR VQMQHEVEES LRRHAGTIIG HEDIDKIRWP GSEWRCLKVQ WDAVLDDKMN  300
PERVCPWWIE PLESAKEKKQ VPALPTTKKA LALNQRSLPG INGQNSAGPS SQTRREDRDL  360
QGQDYSGIHS AQPLQRAPPT DVIHPSKVPI RGSRFGKENP NQLPFPMQGP LHKSLSRSMS  420
LTHEDLSITS SNLSSIGSES LGWPSTESRN ENDVPFGQPG SCSTFKLFGV SLIDRSSELP  480
SLQSAAFNKT SSLLSNPPMR VAPGKTCKKC HRVNNRSCTK VLKLGTALGR AVDLARFHGY  540
TELIAELDSM FEFRGSLINE SSGWHVTCMD DDGDMMQLGD YPWQDFQGVV QKMIICPKEA  600
GIFRISGLVA IVTKEFVSGA GSYSHNSILQ ATVTPALMAA PEKERRRQYP MNMMTTLKLN  660
LGQHMIVSPR ATRTVAFAPP SSVTVSLTHQ HASAPSSSSS LILRHNGTRV RSHSQPFPES  720
DDQVEDLRVP DNWLDPTIAF QESEWLRVTL HKWLDDEYCP EETNVEISRV AANSFYNSLL  780
QKQTDLGEIL LKMARELESI NYKESFHGAF SSANAAIDLI AQRIEQLCQS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1001331446357Auxin response factor 1
4ldw_A1e-1001331446357Auxin response factor 1
4ldw_B1e-1001331446357Auxin response factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN43557.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0924630.0BT092463.1 Soybean clone JCVI-FLGm-11A23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028217803.10.0auxin response factor 2-like
TrEMBLA0A445FJA20.0A0A445FJA2_GLYSO; Auxin response factor
STRINGGLYMA19G39340.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131052329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-106auxin response factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]