PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43531.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HB-other
Protein Properties Length: 1051aa    MW: 117144 Da    PI: 9.3787
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43531.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.96.3e-0769125157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  ++++ ++ ++++F  +  +s++e  e+++ lg+t +qV+ +F  +R + ++
  KHN43531.1  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKELHEISALLGVTVTQVRDFFNAQRSRVRR 125
                 799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.10666126IPR001356Homeobox domain
SMARTSM003891.7E-568130IPR001356Homeobox domain
SuperFamilySSF466898.13E-768132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-569130IPR009057Homeodomain-like
PfamPF000461.9E-469125IPR001356Homeobox domain
CDDcd000862.29E-569126No hitNo description
Gene3DG3DSA:1.20.930.102.4E-5225309IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476764.45E-5231309IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MDAWNEDFSV LEIGSSAESF QKFLVSQKEL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKELHE ISALLGVTVT QVRDFFNAQR  120
SRVRRSVQLS RERVLSSNSC EEPHDDQINS DPMRPINPTP LNSAGQSNTE EASCSTQEVA  180
LPDLDDSDKQ FVDNIFSLIQ KEETFSGQEK LMEWILTIQN FSVLLWFLSR GGGMNLATWL  240
SKAAAEEQTS VLLLILKVLC HLPLHKAIPM HISAILQSVN KLRFYRTSDI SNRARVLLSK  300
WSKLFARNQV IKKPNGVKIS IDGHKEMMLS QRQACILSLF CAQFIGTSFL NYYDFYFCSI  360
GQFMGSESWH SNIDVPEDIL ALSSECSDNF RKMGSPQGVK LLPPSLDDSN KKSSLGVSSS  420
QSRERRKVQL VEQPGQKSVS RSSQVTRAGP VSQGRPMSAD DIQKAKMRAL FMQSKYGKSG  480
SKESKETKID SPNKQPQTNP ASIAACSSKV PTPPKIEENK KPLLLTSKTT NRLEASYSKP  540
KMDVKEPLWE KCKRVQIPWR TPAEVELKDT WRVGGGENSK EVEVQRNRNR RDKEIIYKTV  600
QEMPPNPKEP WDLEMDYDDT LTLEIPIEQL PDGDGADIAI SPNQVGTHTV QGVASTSSTG  660
VATAEPDLEL LAVLLKNPEL VFALTSGQGG SIPNQETVKL LDMIKSGGVN LGLSENTNGS  720
YGTSVKSPEK VEVSLPSPTP LSDPRTSGWS SEASKNPFSR RSLAPDRITQ NHAAVATTNL  780
LSQIPITGTT VRQQPTVVVP SSRHLTSTSV SPYSLPHATN VIPEKPSPLG QVQTSSDVGL  840
TMKNLTTANA SSVNFPGTHS TLALRGDGTN YVKPVPNLSV QHEGLSNSFR QPFMPPSPTP  900
SHSSLQQQRH QHLTQEVHYT EPPYRNPGRS YPPQIEKSDH GSDNMWRVRQ DHVSSSYHSQ  960
RNHNNNYNTM VGGSRQSGFW DRNNHARGEF ESWSPENSPT RNPRYAPGRN YPESRMNHGR  1020
NPRPEWSRQR GSSGHWDPGR QGNRKWHDQR R
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN43531.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353490.0AC235349.1 Glycine max strain Williams 82 clone GM_WBb0092H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553647.10.0homeobox protein LUMINIDEPENDENS
RefseqXP_028217888.10.0homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A445FJL70.0A0A445FJL7_GLYSO; Homeobox protein LUMINIDEPENDENS
TrEMBLI1NB350.0I1NB35_SOYBN; Uncharacterized protein
STRINGGLYMA19G39620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-138HB-other family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]