PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 433aa    MW: 48925.9 Da    PI: 9.9291
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43436.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.4e-07129170446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
       KHN43436.1 129 WTKEETDQLFDLCERFDLR-FIVIADRFPSSRTVEELKDRYYS 170
                      *******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162827.7E-31101175IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007171.8E-6125174IPR001005SANT/Myb domain
SuperFamilySSF466891.71E-6125174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-6128172IPR009057Homeodomain-like
CDDcd116582.97E-19129171No hitNo description
PfamPF054998.6E-6308370IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MDAKDILGLP KNSFPTLEKK SRPPKESQRK PDGISREVYA LTGGLAPLMP ATEASQLKKK  60
PPPLEKITWQ WLPFTSSARK DNLHLYHWVR VVNGVPPTGD YSFAKYNKSV DVIKYTDEEY  120
DKYLTDPMWT KEETDQLFDL CERFDLRFIV IADRFPSSRT VEELKDRYYS VSRAILIARA  180
PSSGDVAAHP IVKETYNFAQ EMERKRALSM VLSQTRQQER RDEEVLVEAK KIAEKRLPPK  240
VAEQSQLVAS NAGAEATERA VPGETISPSN VQIPMAVPDN ASTLASLRML RVYLRTYALE  300
QMVQAANASA GLRTIKRVEQ TLQDLGVNLK PRVPTKAVCA EHLELRKEIL TWLNLQKQVQ  360
YKEAEGSSFR DGSYGETPGT PKHLHRVGDQ DRTFVPDSTN FGVERVGKKD QKRKAPGAPS  420
AHKRPRKLKA SDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A6e-21100185493DNA methyltransferase 1-associated protein 1
4iej_A6e-21100185493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN43436.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0948860.0BT094886.1 Soybean clone JCVI-FLGm-25A17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554562.10.0SWR1-complex protein 4 isoform X1
RefseqXP_028218054.10.0SWR1-complex protein 4 isoform X1
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A445FJT30.0A0A445FJT3_GLYSO; SWR1-complex protein 4 isoform A
TrEMBLI1NBE90.0I1NBE9_SOYBN; Uncharacterized protein
STRINGGLYMA19G40630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49752330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]