PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 273aa    MW: 32659.1 Da    PI: 9.3907
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42520.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.42.1e-2438120186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk  +++e++    +++++p++++ +
  KHN42520.1  38 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTRYKGFETMEQEA---TRQQFPFYNEFN 120
                 7********************************************************************96...45679**99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.38E-2237100No hitNo description
PfamPF138376.5E-2038122No hitNo description
PROSITE profilePS500907.3643995IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEGTHHLRHL HQQQQQKQRV LPQSMSSVNV DVTDRFPQWS IQETKEFLVI RAELDQTFME  60
TKRNKQLWEV ISNRMKEKGY HRSAEQCKCK WKNLVTRYKG FETMEQEATR QQFPFYNEFN  120
AIFTARMQRM LWAEAGGGSK KNKAMTMQLS SDEEDGKEES TEAGSDRKKK KAKIVSGGGG  180
SLNNLKEILE DFMRQQMQIE AQWMVAFEAR ENERRLKEME WRQAMEVLEN ERIMMEERWR  240
EREEQRRIRE EARAEKRDAL ITALLNKLER QGM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-176AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522067.20.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804503e-70TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0B2SBM40.0A0A0B2SBM4_GLYSO; Trihelix transcription factor GT-3b
TrEMBLK7KD370.0K7KD37_SOYBN; Uncharacterized protein
STRINGGLYMA03G07590.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.15e-64Trihelix family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]