PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 657aa    MW: 72566.3 Da    PI: 6.1754
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42494.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.21.8e-28198251155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv+av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  KHN42494.1 198 KPRVVWSVELHRKFVSAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 251
                 79*******************.********************************8 PP

2Response_reg77.16.2e-26141221109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + +++l+++l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +++++++ + +  Ga 
    KHN42494.1  14 VLAVDDDSTCLMVLETLLRRCQY-HVTTTKNAITALNLLRENKtmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNDDPKMVMKGITHGAC 108
                   799********************.***************99999********************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    KHN42494.1 109 DYLLKPVRIEELQN 122
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.4E-1671656IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.9E-4211146No hitNo description
SuperFamilySSF521722.99E-3511136IPR011006CheY-like superfamily
SMARTSM004485.0E-3112124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.41613128IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-2314122IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.68E-2615128No hitNo description
PROSITE profilePS5129410.715195254IPR017930Myb domain
SuperFamilySSF466898.96E-20195255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-30197256IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-25198251IPR006447Myb domain, plants
PfamPF002497.4E-7200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MDDLRDQFPI GMRVLAVDDD STCLMVLETL LRRCQYHVTT TKNAITALNL LRENKTMFDL  60
VISDVHMPDM DGFKLLELVG LEMDLPVIML SVNDDPKMVM KGITHGACDY LLKPVRIEEL  120
QNIWQHVIRR KKIDSKERNK TSDHDKPNAD NGNGRVSAGT GNSDQNGKPS KKRKDQDEDD  180
EEENEDGHDN EDSSTLKKPR VVWSVELHRK FVSAVNQLGI DKAVPKKILD LMNVEKLTRE  240
NVASHLQKYR LYLKRISCVA NRQANLVAAL GTADSSYLRM GSLSGVGHMQ TLTGPQQFHN  300
NAFRPFPPGG MIGRLNASVG LNMHGISSSE ALQLSHAQNL NKSINDPLKF QSAIACGNQN  360
GIQGMPMSIG LDQLQHNKGV SVGPIQNMSS LIDDRPTFGV SKKLSDQTQK VTIGCSPSPV  420
LDISNNDLVL KADSENTQGG GVYENLTSVA SQHSQFSLPL LDHGRCSDIW SSPMQSSGTN  480
SYPPSETLQG GNLSGQSSIT SLFNQSHDSP TDMHSQGLIF TNNLGQMSNN VPFQGWDDNN  540
HDSNYDANVI GNSIDTLIDP EGHTSINSNY NRNLDFNFCN PLQMKHDGIM GLSEENSLKQ  600
QYGYIMNRQK SQNSSATNNL GSLEDFASSM MKQKQDKVKF LDGSYLCNNN YPAGTSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-25197257464ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN42494.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2362210.0AC236221.2 Glycine max clone GM_WBc0105L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014622044.10.0two-component response regulator ARR12
RefseqXP_028199202.10.0two-component response regulator ARR12-like
SwissprotQ6K8X61e-140ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0B2SDX40.0A0A0B2SDX4_GLYSO; Two-component response regulator
STRINGGLYMA14G13320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-135response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]