PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 302aa    MW: 33558.1 Da    PI: 10.1372
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42444.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-1258102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a++++  + Wk+I + +g  ++  q++s+ qky
       KHN42444.1  58 RENWTEPEHDKFLEAIQLFDRD-WKKIEAFVG-SKSVIQIRSHAQKY 102
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-1552108IPR009057Homeodomain-like
PROSITE profilePS5129413.91153107IPR017930Myb domain
TIGRFAMsTIGR015578.8E-1856105IPR006447Myb domain, plants
SMARTSM007175.2E-1057105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-65798IPR009057Homeodomain-like
PfamPF002493.5E-1058102IPR001005SANT/Myb domain
CDDcd001677.98E-860103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVSKNPNPPE GFYLDPSGGM ALPGKPPFAS VSAAAAAANS SEDAAKKIRK PYTITKSREN  60
WTEPEHDKFL EAIQLFDRDW KKIEAFVGSK SVIQIRSHAQ KYFLKVQKSG TSEHLPPPRP  120
KRKAAHPYPQ KASKNAPVLS QVSGRFQSSS ALLEPGYISK NDAPPMLKTP IMNTVSSSWS  180
NNTLQTVNLS PVKKVNNPCS SGESTPKVRP VGESNGQGNK IHPLRVLPDF TEVYGFIGSL  240
FDPNATEHLQ KLKKMDRIDV ETVLLLMRNL SINLTSPDFE HHRKLLSSYE VEPERDNNYQ  300
RG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN42444.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0932340.0BT093234.1 Soybean clone JCVI-FLGm-17C23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235967.10.0MYB transcription factor MYB136
SwissprotQ8H0W31e-117RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0B2SDS60.0A0A0B2SDS6_GLYSO; Protein REVEILLE 6 isoform A
TrEMBLA0A0R0IDQ20.0A0A0R0IDQ2_SOYBN; Uncharacterized protein
TrEMBLQ0PJI50.0Q0PJI5_SOYBN; MYB transcription factor MYB136
STRINGGLYMA09G24400.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-99MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]