PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 517aa    MW: 57490.9 Da    PI: 6.2284
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42281.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.91.1e-1251495174374
        GRAS   4 lLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +L  cA+avs++d   a+  + + l +++s +gdp+qRl ay++e+L+arl +s++ +yk+l++++ +   s+e +++++++++++P+ kf+++ aN  
  KHN42281.1 149 VLRVCAQAVSDDDVPTARGWMDNvLGKMVSVSGDPIQRLGAYLLEGLRARLESSGNLIYKSLNCEQPT---SKELMSYMHILYQICPYWKFAYISANAV 244
                 6788***************997627888***************************************9...99999*********************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I ea+++e+r+HiiDf+i qG+QW  L+qaLa Rp+gppslR+Tgv++++s   +   l+ +gerL++fA+++gvpfef+  +a +  ++   +++v p
  KHN42281.1 245 IEEAMANESRIHIIDFQIAQGTQWHLLIQALAHRPGGPPSLRVTGVDDSQSIhaRGGGLQIVGERLSDFARSCGVPFEFRS-AAISGCEVVRGNIEVLP 342
                 ************************************************9988889999***********************.56666677799****** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 gEalaV++ + lh+++desvs+e++rd++L+lvk+lsPkvv++veqe+++n+++F++rf+e+l+yy+a+f+s+++  pr++++ri+ E+++++r+ivn+
  KHN42281.1 343 GEALAVSFPYVLHHMPDESVSTENHRDRLLRLVKRLSPKVVTIVEQESNTNTSPFFHRFVETLDYYTAMFESIDVACPRDDKKRISAEQHCVARDIVNM 441
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +aceg er+erhe l+kWr+rl++aGFk+ +ls++++  ++ ll++++++ yr+e+++g+l+lgW++r + + SaWr
  KHN42281.1 442 IACEGVERVERHELLGKWRSRLSMAGFKQCQLSSSVMVAIQNLLKEFSQN-YRLEHRDGALYLGWMNRHMATSSAWR 517
                 ************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.077120498IPR005202Transcription factor GRAS
PfamPF035144.0E-123149517IPR005202Transcription factor GRAS
Gene3DG3DSA:3.40.50.1501.9E-4282474IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MLQSNLCHDS SSQGTSVSFE TCKEQYFTLE SCPAPTTCFV DCDDSPSYAS VSSKRTPFSP  60
QGSQSCYSDH QQSSDNTYGS PISGLSSVDD GHELKHKLRE LEISLLGPEQ SDSCGCCVVK  120
GGLQGSSQLA KHNWDQIAEN VAQFDLKGVL RVCAQAVSDD DVPTARGWMD NVLGKMVSVS  180
GDPIQRLGAY LLEGLRARLE SSGNLIYKSL NCEQPTSKEL MSYMHILYQI CPYWKFAYIS  240
ANAVIEEAMA NESRIHIIDF QIAQGTQWHL LIQALAHRPG GPPSLRVTGV DDSQSIHARG  300
GGLQIVGERL SDFARSCGVP FEFRSAAISG CEVVRGNIEV LPGEALAVSF PYVLHHMPDE  360
SVSTENHRDR LLRLVKRLSP KVVTIVEQES NTNTSPFFHR FVETLDYYTA MFESIDVACP  420
RDDKKRISAE QHCVARDIVN MIACEGVERV ERHELLGKWR SRLSMAGFKQ CQLSSSVMVA  480
IQNLLKEFSQ NYRLEHRDGA LYLGWMNRHM ATSSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-5518051736375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977040.0BT097704.1 Soybean clone JCVI-FLGm-22M20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240165.10.0uncharacterized protein LOC100792931
RefseqXP_014632837.10.0PREDICTED: uncharacterized protein LOC100792931 isoform X1
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLC6TJ610.0C6TJ61_SOYBN; Uncharacterized protein
STRINGGLYMA07G39650.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13