PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 308aa    MW: 33913 Da    PI: 7.3981
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42061.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.72e-4381071100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q ++el+ +k+
  KHN42061.1   8 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELSAAQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHKLRQIQVELSNAKK 106
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KHN42061.1 107 E 107
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7487108IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELSAAQ  60
RDDAVKSLAY EAEARLRDPV YGCVGLISVL QHKLRQIQVE LSNAKKELAN YIGPQALQGI  120
PAPMLQQHPN NPFPGAMYGN MPTATASVHG GQLVIRDAQP VPHHHHHHQQ QILEAQQLAA  180
AVAAREQQEM FRSYEHQQQQ EFLRFSGGGF DMGSASSAGG FSQVSPAAGS ADQLSPSLAL  240
GSFDNAYHMQ QQPQQGEPHH HHHPHHIPLA AQLLLPPQQK QQTHHESQLP LHRQHSESEE  300
CRSVGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4811244126LOB family transfactor Ramosa2.1
5ly0_B4e-4811244126LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN42061.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351830.0AC235183.1 Glycine max strain Williams 82 clone GM_WBb0008G09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538822.10.0LOB domain-containing protein 36
RefseqXP_006590661.10.0LOB domain-containing protein 36
RefseqXP_014619341.10.0LOB domain-containing protein 36
RefseqXP_028188561.10.0LOB domain-containing protein 36-like
RefseqXP_028188562.10.0LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-72LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A445HYG70.0A0A445HYG7_GLYSO; LOB domain-containing protein 36 isoform A
TrEMBLK7LN930.0K7LN93_SOYBN; Uncharacterized protein
STRINGGLYMA11G06210.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-67ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  3. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]