PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41684.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 248aa    MW: 28016.7 Da    PI: 9.0007
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41684.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.58.8e-19166200135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  KHN41684.1 166 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 200
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.846160196IPR000679Zinc finger, GATA-type
SMARTSM004011.5E-16160214IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-14163222No hitNo description
Gene3DG3DSA:3.30.50.101.3E-14164198IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.72E-14165213No hitNo description
PROSITE patternPS003440166191IPR000679Zinc finger, GATA-type
PfamPF003201.2E-16166200IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MECLEAALKT SFWKDMALKQ TLLLEEFSSA FNVQNVVASS DDFFLDDLLN LSLLENNNEE  60
PDQQHKNHDS TPQNNQENYN YNLSFNDNSF NTELTIPALY YSNFSKYFLP FPATLAEKVK  120
SPEPGNTGFT FKTPVPAKTR SKPTQTANPR VKKRAVIDGA VAARRCSHCG VQKTPQWRTG  180
PLGAKTLCNA CGVRFKSGRL LPEYRPACSP TFSIKLHSNH HRKVLEMRRK KEVLLEPDTS  240
SPWSIPGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519878.11e-110PREDICTED: GATA transcription factor 5
TrEMBLA0A0B2SBK40.0A0A0B2SBK4_GLYSO; GATA transcription factor 5
STRINGGLYMA02G05710.21e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-44GATA transcription factor 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]