PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 197aa    MW: 22786 Da    PI: 9.3143
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41615.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601162.4e-3611109199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++r+kC+++C+l pyfp++++++f +vhk+FG+sn++kl+k+++ee+r+++++sl++eA++r+rdP++G +g ++k+ ++++++  e+++ ++
  KHN41615.1  11 ACAACKHQRKKCSENCILEPYFPSNRSREFYAVHKVFGVSNITKLVKNAKEEDRRKVVDSLIWEACCRQRDPIQGPYGEYTKVYNEYKKVLDEIKRFRS 109
                 7****************************************************************************************9999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.75410111IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3411106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQRNNSGMHP ACAACKHQRK KCSENCILEP YFPSNRSREF YAVHKVFGVS NITKLVKNAK  60
EEDRRKVVDS LIWEACCRQR DPIQGPYGEY TKVYNEYKKV LDEIKRFRSQ NQLLQIPSLG  120
FKSVQDLIAC NGTKGEHKAS VNNASNYLHG KKNGIIDTNI YNTYCSNYLL EFQNIRPEVV  180
IPFQQHSQPY YITGINL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-1941044104LOB family transfactor Ramosa2.1
5ly0_B8e-1941044104LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN41615.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-124AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025980561.11e-144LOB domain-containing protein 2
SwissprotQ9LNB97e-37LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A0B2S8T41e-146A0A0B2S8T4_GLYSO; LOB domain-containing protein 2
STRINGGLYMA12G14101.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-39LOB domain-containing protein 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]