PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 345aa    MW: 38324.5 Da    PI: 4.8849
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41397.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS185.53.5e-571673431178
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l+e L +cA+av+ +d+e +++l+++l++++s +g+p+qRl ay++eAL arla+s+s+++k l+++e +   sse l+ ++l++e++P+lkf+++ aN
  KHN41397.1 167 LKEMLCTCAKAVAGNDMETTEWLMSELRKMVSVSGNPIQRLGAYMLEALVARLASSGSTIFKVLKCKEPT---SSELLSQMHLLYEICPYLKFGYMSAN 262
                 5789*****************************************************************9...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                  aI e +++e++vHii f+i+qG+QW++L+qa+a Rp+ pp++RiT +++++s    +  le +g rL+++A++ +vpfe 
  KHN41397.1 263 GAIAEVMKEESEVHIIHFQINQGIQWVSLIQAIAGRPGAPPKIRITSFDDSTSAyaMEGGLEIVGARLSRLAQSYNVPFES 343
                 **************************************************998899999********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.138141345IPR005202Transcription factor GRAS
PfamPF035141.2E-54167343IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MSYDSSRFSI EPVQNLGSCC FLQSGNLDYS SSSDNGSHTT YPSVCIFEQY CTLESSTNNN  60
FPSLNSPSTV SFSPNNSPVS KLHSKAYVLS SQNLLEIVNE SLENKSFLTL NDDELRHKIR  120
ELESAMLGHD TDILDTYDTI IPKESDSFLK EAERWKRMMA MISRGDLKEM LCTCAKAVAG  180
NDMETTEWLM SELRKMVSVS GNPIQRLGAY MLEALVARLA SSGSTIFKVL KCKEPTSSEL  240
LSQMHLLYEI CPYLKFGYMS ANGAIAEVMK EESEVHIIHF QINQGIQWVS LIQAIAGRPG  300
APPKIRITSF DDSTSAYAME GGLEIVGARL SRLAQSYNVP FESNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-191713428179GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588180.10.0PREDICTED: scarecrow-like protein 5
SwissprotQ9LDL73e-93PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0B2SAV30.0A0A0B2SAV3_GLYSO; Scarecrow-like transcription factor PAT1
STRINGGLYMA09G22110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3577622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.23e-91GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]