PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family YABBY
Protein Properties Length: 188aa    MW: 21127.1 Da    PI: 8.2991
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41251.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY224.52.9e-6961625170
       YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklse 103
                  ++e+vCyv+CnfCntilavsvP++sl+++vtvrCGhC++llsvn+  + q+ + ++   +s    +++ l +ee +    +e  +s+s+ ++   + e
  KHN41251.1   6 MATERVCYVHCNFCNTILAVSVPYSSLLTIVTVRCGHCANLLSVNMGASLQAFPPQDP--QS----QKQLLSFEEPSSC--KELGSSSSKCNKIAPFHE 96 
                 689**************************************************99996..22....2222333332222..222233333333444568 PP

       YABBY 104 nedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   ++e pr+pp irP ekr rvPsaynrfikeeiqrikasnPdishreafs aaknWahfP+ihfgl
  KHN41251.1  97 AVEHEQPRIPP-IRPTEKRHRVPSAYNRFIKEEIQRIKASNPDISHREAFSSAAKNWAHFPHIHFGL 162
                 889999**999.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.7E-737162IPR006780YABBY protein
SuperFamilySSF470951.57E-7107155IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.1E-4115156IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSMEMMATER VCYVHCNFCN TILAVSVPYS SLLTIVTVRC GHCANLLSVN MGASLQAFPP  60
QDPQSQKQLL SFEEPSSCKE LGSSSSKCNK IAPFHEAVEH EQPRIPPIRP TEKRHRVPSA  120
YNRFIKEEIQ RIKASNPDIS HREAFSSAAK NWAHFPHIHF GLKNLKLDGN KQEKLDQGEG  180
AEKSNGFY
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN41251.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0905710.0BT090571.1 Soybean clone JCVI-FLGm-4H4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001344735.11e-140protein YABBY 9 isoform 2
RefseqXP_025984467.11e-140transcription factor YABBY9 isoform X4
SwissprotQ9XFB08e-77YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A445KG971e-138A0A445KG97_GLYSO; Putative axial regulator YABBY 2 isoform A
TrEMBLI1KFH51e-138I1KFH5_SOYBN; Uncharacterized protein
STRINGGLYMA12G10210.31e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-76YABBY family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]