PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 359aa    MW: 39736.2 Da    PI: 9.2785
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41045.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32245298255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN41045.1 245 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 298
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15242298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28243298IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24245298IPR006447Myb domain, plants
PfamPF002496.0E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTAPDLSL HISPPTISSS SLISNHGSNN FPSRTTTLFQ QAHTELSLGR  60
NFTSETPTPT PTPTPTPHNP YYQSLNHFHH LHHHHNHNNN NNTSTSVNTT STTTTNTPLN  120
HINYGVSLLD VSSSDTLRPI KGIPVYHNRS FPFVAAMDHA RDDDNNNNKD HHHHHKMCLY  180
NNHHNMPSYH PSLSPSTVAP SPSPYFVDPM SLLNNGSTMA ACASSGFMRS RFLQKLPNKR  240
SMRAPRMRWT STLHARFVHA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK  300
TTDKPAASSG HSDGSGEDDL SPMGSTADRG GLRQFPKRTA GMAGATRHGL PFHHPYPME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16246300458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN41045.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028215766.11e-169transcription repressor KAN1-like
TrEMBLA0A445LTI81e-168A0A445LTI8_GLYSO; Transcription repressor KAN1
STRINGGLYMA02G40930.21e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-51G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]