PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40974.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 227aa    MW: 24398 Da    PI: 9.0001
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40974.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25e-42201191100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe +r da++slvyeA+ r+rdPvyG++g i++lqqq+++l++el+++++
  KHN40974.1  20 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPEGQRADAANSLVYEANLRIRDPVYGCMGAISALQQQVQRLQVELNATRA 118
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KHN40974.1 119 E 119
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6819120IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4220117IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRKHFYGPT PGTTLNTVTP CAACKLLRRR CAEECPFSPY FSPHEPQKFA AVHKVFGASN  60
VSKMLMEVPE GQRADAANSL VYEANLRIRD PVYGCMGAIS ALQQQVQRLQ VELNATRAEI  120
LKYKYREAAC IISSHHHVAL VSSADAISIA AIPADSSQGL SQPQIQPHPP PPPPKPLPSP  180
PPPKPLPSPS ILLSSLSSSS ASSVYTPPKS TMSLGSISTT ENVPYFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-46131314122LOB family transfactor Ramosa2.1
5ly0_B6e-46131314122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN40974.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-136AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518338.21e-164LOB domain-containing protein 15 isoform X1
RefseqXP_006575444.11e-164LOB domain-containing protein 13 isoform X2
RefseqXP_028215056.11e-164LOB domain-containing protein 15-like isoform X1
RefseqXP_028215059.11e-164LOB domain-containing protein 13-like isoform X2
SwissprotQ9AT616e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A445LSZ41e-163A0A445LSZ4_GLYSO; LOB domain-containing protein 13 isoform A
TrEMBLI1JHK61e-163I1JHK6_SOYBN; Uncharacterized protein
STRINGGLYMA02G40080.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-67LOB domain-containing protein 13
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]