PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 414aa    MW: 47049.8 Da    PI: 5.236
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40733.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF321.6e-10948140
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                k+i n + r   f+kR++ ++KK  E S  C++++++i++
  KHN40733.1  9 KPIPNGRDRDLAFTKRKKALMKKMTEFSNVCGVKACMIMY 48
                6789999*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.297148IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-5162IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-14286IPR002100Transcription factor, MADS-box
PfamPF003192.4E-101150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MGRPKLILKP IPNGRDRDLA FTKRKKALMK KMTEFSNVCG VKACMIMYDG NYGDAPPLTW  60
PQDDPIEVHS IIKRYESIKN EKLPKNFDLN NFFEIRKNMV DNDISKVQKE TLKIKYPTWH  120
PSFNNLGVEE LRNFIARLDI KLEACNQRNE MSKHNHQNEA NFNFMQSMVQ SDSVAPNPSQ  180
LNFMQEISQN QFSLAPMRPL NDGNQVASYL LNLDIGSSSQ SQMLNFDPNL MQLIAKNQGV  240
MDITNQVDVP LACANQINAL GNFTNQHDVP VDLTNHQLGE CLDYFSQLDE IEDLTSQLNE  300
IVNSGSQPGE SIIWTNQHGV PVIGGSTTAM NGATNYGTKF HGDEHNQESS HCNYNEVVQS  360
MQPYNYDAAL QNIASQSENV QQIVTWPSLL PPKDEFQTDH YNKTLQNQYS NHFI
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN40733.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020206215.10.0agamous-like MADS-box protein AGL103
TrEMBLA0A0B2S7N30.0A0A0B2S7N3_GLYSO; Agamous-like MADS-box protein AGL82
STRINGGLYMA15G23335.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.19e-17M-type_MADS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]