PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 572aa    MW: 62794 Da    PI: 6.2825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40575.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.15.1e-1262065612374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lLl+cAeavss++le a+++L ++s+l++p g++ qR+aayf eA++arl++s+ ++y++lp +++s     ++++a+++f+ +sP++kfsh+taNq
  KHN40575.1 206 LTLLLQCAEAVSSENLEDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPHTHQS----HKVASAFQVFNGISPFVKFSHFTANQ 300
                 579*********************************************************999988885....89999********************* PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                 aI ea+e+eervHiiD+di+qGlQWp L++ LasRp+g+p +R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++ +l++e+L+v + 
  KHN40575.1 301 AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGAPYVRLTGLGT----SMEALEATGKRLSDFANKLGLPFEFFP-VAEKVGNLDPERLNVCKT 394
                 *************************************************....***************************.7***************** PP

        GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                 Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++ n++sFl rf+ea++yysalfdsl +++++eseer++vE++ll+rei+nv+
  KHN40575.1 395 EAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLS-NTGSFLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVL 486
                 ********9..999999999999....*******************97.699*********************************************** PP

        GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 a  g +r+ + + +++Wre+l+++GF+ ++l  +aa+qa+lll +++s+gy++ e++g l lgWkd  L+++SaWr
  KHN40575.1 487 AVGGPSRTGEPK-FHNWREKLQQCGFRGISLAGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAWR 561
                 ******998887.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.074179541IPR005202Transcription factor GRAS
PfamPF035141.8E-123206561IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MDDTSAAAAT SGWIDGILKD LIHSSNSVSI PQLISNVREI IYPCNPNLAM VLEYRLRLLL  60
TESTTQNKRG TEGVPLPPSV SSVKLTSNRV VDGIVPNLHF TDASGGAVVV NQHMLSNWGV  120
PQITPHHDNT NTNTNTNNSN NPSVSLVTLP SPTPPLPPPH YSPPQEKHPQ EEDLAATSTA  180
EVALSRKKKE ELREQKKKDE EGLHLLTLLL QCAEAVSSEN LEDANKMLLE ISQLSTPFGT  240
SAQRVAAYFS EAISARLVSS CLGIYATLPH THQSHKVASA FQVFNGISPF VKFSHFTANQ  300
AIQEAFEREE RVHIIDLDIM QGLQWPGLFH ILASRPGGAP YVRLTGLGTS MEALEATGKR  360
LSDFANKLGL PFEFFPVAEK VGNLDPERLN VCKTEAVAVH WLQHSLYDVT GSDTNTLWLL  420
QRLAPKVVTV VEQDLSNTGS FLGRFVEAIH YYSALFDSLG SSYGEESEER HVVEQQLLSR  480
EIRNVLAVGG PSRTGEPKFH NWREKLQQCG FRGISLAGNA ATQASLLLGM FPSEGYTLVE  540
DNGILKLGWK DLCLLTASAW RPPFHSAITH HN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-532055614375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551631.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9AVK40.0SCR_PEA; Protein SCARECROW
TrEMBLA0A0B2S5Q60.0A0A0B2S5Q6_GLYSO; Protein SCARECROW
STRINGGLYMA18G45220.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]