PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40398.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 270aa    MW: 30348.2 Da    PI: 9.2032
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40398.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.4e-332175155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  KHN40398.1 21 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 75
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-321876IPR009057Homeodomain-like
PROSITE profilePS5129412.4551878IPR017930Myb domain
SuperFamilySSF466892.87E-162178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-242176IPR006447Myb domain, plants
PfamPF002497.9E-92374IPR001005SANT/Myb domain
PfamPF143791.0E-23119164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEGGGREGYN GVIMTMTRDP KPRLRWTADL HDRFVDAVTK LGGPDKATPK SVLRLMGLKG  60
LTLYHLKSHL QKYRLGQQAQ KQNEEVHKEN SRCSYVNFSN RSLAPNTSYR GDDEGGEIPI  120
AEALRCQIEV QKRLEEQLKV QKKLQMRIEA QGKYLQSVLE KAQRSLSLDG PGSLEASRAE  180
LTEFNSALSN FMENMNKDSK QNIIEVNNFY SKSHGSAFYN QEVGREQNRD QKPKVEGGSI  240
QFDLNIKGSN DLVSAGGAEM DANMVSSYRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-121AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516829.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK54e-51APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0B2S6R30.0A0A0B2S6R3_GLYSO; Myb family transcription factor APL
TrEMBLI1J4K90.0I1J4K9_SOYBN; Uncharacterized protein
STRINGGLYMA01G01300.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.19e-78G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]