PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40296.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 655aa    MW: 73925.7 Da    PI: 7.2009
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40296.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.6e-1102836531374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+av+++d + a++lL+r++++++p gd +qRla+ f+ +L+arla+++s++yk l +++ts    ++ l+a++l+  ++P+ k++ ++ N
  KHN40296.1 283 LRTLLVLCAQAVAADDYKSAHELLKRIRQHSNPFGDGNQRLAHIFADGLEARLAGTGSQIYKGLVSKRTS---AADFLKAYHLYLAACPFRKMTAFISN 378
                 5789************************************************************999999...9************************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  +I ++ +++ r+HiiDf+i +G+QWp+L+q L+  ++g+p+lRiTg++ p++g   +e++ etg rLa +Ae+++v+fe+n+ +ak++e+++leeL++
  KHN40296.1 379 VTIRKSSANSPRLHIIDFGILYGFQWPTLIQRLSL-AGGAPKLRITGIDFPQPGfrPAERIVETGCRLAAYAESFKVEFEYNA-IAKKWETIQLEELKI 475
                 *********************************99.79***************9*****************************.7************** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +++E l+V + ++ +++ldesv ++s+r+++L+l+++++P+++++   +   n++ F++rf eal +ys+lfd+le+ +pre+ er+ +E+e++gre+ 
  KHN40296.1 476 DRDEYLVVTCFYRCKNVLDESVVVDSPRNKFLSLIRKVNPNIFIHGITNGAFNAPFFVTRFREALFHYSSLFDMLETIVPREEWERMLIEKEIFGREAL 574
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 nv+aceg er+er et+++W++r+ +aGF + p++ +++k a   + + + + + ++e+s++l++gWk+r ++++S+W+
  KHN40296.1 575 NVIACEGCERVERPETYRQWQARILRAGFLQQPFEREIVKRAIEKVTTSYHKDFVIDEDSQWLLQGWKGRIIYALSCWK 653
                 ******************************************99999999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.654257633IPR005202Transcription factor GRAS
PfamPF035145.4E-108283653IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MEEDMEDKTC MRQDSLDLQI AERSFYEVIG EKYPSTPLGH PSSVDPDDGS GEHNLSENYG  60
TCSYNDGDLS SIFTNNFLRR NLGELPNQNF RGNSISQSSY SSSNSVKSSV EGPVDSPSSI  120
LQVPDLNSET QSILQFQKGV EEASKFLPSG NGLFANLGVA NFSKLEPRVG SDELPVKVEK  180
DEGESFPAGS KIRKHHHMEE EDVEENRSSK QAAIFSEPTL RSSMIDIILL HSLGDGKKHF  240
MARREALQTK NDQIVVSNGK SKASNGGKGR SKKQNGKKEV VDLRTLLVLC AQAVAADDYK  300
SAHELLKRIR QHSNPFGDGN QRLAHIFADG LEARLAGTGS QIYKGLVSKR TSAADFLKAY  360
HLYLAACPFR KMTAFISNVT IRKSSANSPR LHIIDFGILY GFQWPTLIQR LSLAGGAPKL  420
RITGIDFPQP GFRPAERIVE TGCRLAAYAE SFKVEFEYNA IAKKWETIQL EELKIDRDEY  480
LVVTCFYRCK NVLDESVVVD SPRNKFLSLI RKVNPNIFIH GITNGAFNAP FFVTRFREAL  540
FHYSSLFDML ETIVPREEWE RMLIEKEIFG REALNVIACE GCERVERPET YRQWQARILR  600
AGFLQQPFER EIVKRAIEKV TTSYHKDFVI DEDSQWLLQG WKGRIIYALS CWKPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-392876538375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530209.20.0PREDICTED: scarecrow-like protein 9
RefseqXP_006583594.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0B2S0R50.0A0A0B2S0R5_GLYSO; Scarecrow-like protein 9
STRINGGLYMA07G15950.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]