PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 339aa    MW: 37772.4 Da    PI: 8.0023
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39835.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.51.8e-18256289134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  KHN39835.1 256 CSHCQVQKTPQWRIGPLGPKTLCNACGVRFKSGR 289
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.108250286IPR000679Zinc finger, GATA-type
SMARTSM004014.1E-13250300IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.4E-14254287IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577166.18E-13254314No hitNo description
CDDcd002024.01E-13255312No hitNo description
PfamPF003203.4E-16256289IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
TPIPQLKRLF RLTKGNSTAV SLSSLSSLLS FLNSSVGTRK MEVAAAKALK PSLRTEFIFP  60
QAIYDEILCF NANNVVADED FSMDDLLDFS NGEFQVGKDF DDYEEEEDEE KNSTSGSLQS  120
QDRAEDDNNS NSTAGGGGHD YVFAGELSVP ADDVADLEWV SHFVDDSLPE LSILYPIHCS  180
KKTRVWAEPE SRLSPAQTVS KVPRKSRTEK PRKPNTRVWS SFTVFAGSVG FGELVTKKQK  240
KKVEAQSGGA QSLRRCSHCQ VQKTPQWRIG PLGPKTLCNA CGVRFKSGRL FPEYRPACSP  300
TFCGHIHSNN HRRVLEMRWK KQIAESVTGS DRKQLIPNY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352640.0AC235264.1 Glycine max strain Williams 82 clone GM_WBb0041H18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539005.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_014619472.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0B2S3K00.0A0A0B2S3K0_GLYSO; GATA transcription factor 7 (Fragment)
STRINGGLYMA11G11930.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-51GATA transcription factor 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]