PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39497.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 436aa    MW: 48606.3 Da    PI: 7.6338
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39497.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.4e-1660104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
       KHN39497.1  60 RERWTDEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1754108IPR009057Homeodomain-like
PROSITE profilePS5129420.92455109IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1658107IPR006447Myb domain, plants
SMARTSM007174.7E-1359107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-960102IPR009057Homeodomain-like
PfamPF002491.3E-1360103IPR001005SANT/Myb domain
CDDcd001674.48E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MAIQGQNAFT RSQGGLPIGD EISFNSGVHS VADIPLHDQL SCGNDYALKV RKPYTITKQR  60
ERWTDEEHKK FLEALKLYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKILR ESSGNSTTLE  120
ESIEIPPPRP KRKPIHPYPR KLVEFPKTGI SNSEHPLRSN SLKSSDFGQE NNSPKSVLST  180
VVSETVGSSD SDTSSRCLSP ASSISGVPTN RFPLAEPKTS FKEEGSAPSS AHDEQPPVKL  240
EFFHKESVST RDDATEESSG RTLKLFGTTL LVTDTCKPSS PTTEPCKPTP AAAMYLMQLQ  300
NGCSDVTEGH ASIVPWWTLP HNTPFMPLHK EPKGKHLYSN LGEFEHKEVQ KEGSWTGSNT  360
SSIDDGDNTE KSDDQAKSHV HGFSKSETLT ISELRVRPKT CGKGFVPYKR CMAERENQCS  420
SVYYEEREEQ RIKLSL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN39497.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311810.0KT031181.1 Glycine max clone HN_CCL_152 MYB/HD-like transcription factor (Glyma02g40800.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028201167.10.0protein REVEILLE 1-like
TrEMBLI1MBR60.0I1MBR6_SOYBN; Uncharacterized protein
STRINGGLYMA14G39130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-53MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]