PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39485.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 403aa    MW: 44701.8 Da    PI: 8.9277
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39485.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32273326255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN39485.1 273 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 326
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15270326IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28271326IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-24273326IPR006447Myb domain, plants
PfamPF002497.1E-7274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTTAPDLS LHISPPTISS LNSNYEPHES NFPSRTTTVS QQAHTELSLG  60
RNFTSETPIP TPHNPYYQSQ NHFHHLHHHH HNNNNTSTSV NTTSVVTSTT STTPLNHINY  120
GVSLLDVSSS DTLRPIKGIP VYHNRSFPFV ATMDHARDNL NNNNNNNKDH YHHHKMCLYN  180
HHNMPSYPSL SSSTATPSPS PYFVDPMSLL NNGSTMAACR AATATRFNGF SGDAFKSHHP  240
LHQYGVGPSE ASSGFMRSRF LQKLPNKRSM RAPRMRWTST LHARFVHAVE LLGGHERATP  300
KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSGHS DGSGEDDLSP MVSTIVVVSD  360
NFPTTEGGRS GRHNKTWTTL PPPLLYGVIL QGTTLTNFHF YIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN39485.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544358.10.0transcription repressor KAN1
RefseqXP_028199153.10.0transcription repressor KAN1-like
TrEMBLA0A445HA690.0A0A445HA69_GLYSO; Transcription repressor KAN1
TrEMBLK7M8D20.0K7M8D2_SOYBN; Uncharacterized protein
STRINGGLYMA14G39260.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.19e-46G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]