PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39307.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 226aa    MW: 25263.9 Da    PI: 4.2974
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39307.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.61.1e-1014358100
      DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 m++++y++++ra dPv G+++ il+lq q+e  +ael+l+ ++
  KHN39307.1   1 MRTIIYQSDMRATDPVGGCYRYILELQAQIEYYRAELELVLQQ 43 
                 89***********************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.89144IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-7140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MRTIIYQSDM RATDPVGGCY RYILELQAQI EYYRAELELV LQQLAIFRAQ AQHQHQQQHG  60
IFAANNVNVA VNGDGEVLNG DPMGLYNQQQ HYQCLQAQQG EEQYVMMHEN GNGSQNIDGI  120
ALQEQIKTWA VQNTAVSLSS LSLHGQNSNV SDEYDHKPVV GIDMDSDERS ELGFESEELV  180
HRSDEAVLFK IDDAVIKAEA NPCMQQAQDH DLKGAATSFT LTNCSC
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN39307.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028240640.11e-167LOB domain-containing protein 22
TrEMBLA0A445JQF81e-166A0A445JQF8_GLYSO; LOB domain-containing protein 22
STRINGGLYMA07G01170.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-16LOB domain-containing protein 22
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]