PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 190aa    MW: 22112.6 Da    PI: 4.6191
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39199.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM115.84.4e-3681271128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF Ptdeelvv++L++k++  +++  +vi+++++y ++Pw+L+ ++ ae k+wy++s+r         +nr+t++gyW   g +++v+s+ +++
  KHN39199.1   8 LPPGFRFYPTDEELVVHFLQRKANLLPCHP-DVIPDLELYPYDPWELHGRALAEGKQWYYYSRRT--------QNRVTSNGYWMPMGMEEPVISNsSNK 97 
                 79*************************999.99**************97777889*******984........58*****************9986777 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg+kk  vf+ g+ap+g+ t+W+m+eyrl
  KHN39199.1  98 RVGMKKYYVFHLGEAPDGNTTNWIMQEYRL 127
                 8***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-475157IPR003441NAC domain
PROSITE profilePS5100545.3438158IPR003441NAC domain
PfamPF023653.3E-229127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGDNNVNLPP GFRFYPTDEE LVVHFLQRKA NLLPCHPDVI PDLELYPYDP WELHGRALAE  60
GKQWYYYSRR TQNRVTSNGY WMPMGMEEPV ISNSSNKRVG MKKYYVFHLG EAPDGNTTNW  120
IMQEYRLLDS ASSSISSRRR SQPKPDHSKW VICRVYERDN DEDDGDGTEL SCLDEVFLSL  180
DDLDEISLPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-40416013167NO APICAL MERISTEM PROTEIN
1ut4_B3e-40416013167NO APICAL MERISTEM PROTEIN
1ut7_A3e-40416013167NO APICAL MERISTEM PROTEIN
1ut7_B3e-40416013167NO APICAL MERISTEM PROTEIN
3swm_A3e-40416016170NAC domain-containing protein 19
3swm_B3e-40416016170NAC domain-containing protein 19
3swm_C3e-40416016170NAC domain-containing protein 19
3swm_D3e-40416016170NAC domain-containing protein 19
3swp_A3e-40416016170NAC domain-containing protein 19
3swp_B3e-40416016170NAC domain-containing protein 19
3swp_C3e-40416016170NAC domain-containing protein 19
3swp_D3e-40416016170NAC domain-containing protein 19
4dul_A3e-40416013167NAC domain-containing protein 19
4dul_B3e-40416013167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN39199.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-120AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003531051.11e-141NAC domain-containing protein 104
RefseqXP_028247050.11e-141NAC domain-containing protein 104-like
SwissprotQ8GWK61e-86NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0B2S4H51e-140A0A0B2S4H5_GLYSO; NAC domain-containing protein 104
TrEMBLI1KR611e-140I1KR61_SOYBN; Uncharacterized protein
STRINGGLYMA08G08010.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-87xylem NAC domain 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]