PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38855.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 278aa    MW: 30635.5 Da    PI: 6.671
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38855.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.65.3e-12113153343
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      +WT+ E+el+v++  ++G+g+W++Ia+++  ++t+ q++s+
       KHN38855.1 113 SWTQGEHELFVKGLIKYGKGDWAKIAEEFVCNKTPQQVQSY 153
                      7*****************************899*****998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.02106162IPR017930Myb domain
SMARTSM007171.2E-8110160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-11111162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-8112159IPR006447Myb domain, plants
SuperFamilySSF466891.05E-11113162IPR009057Homeodomain-like
CDDcd001679.48E-10113154No hitNo description
PfamPF002494.1E-10113153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVLEIIDLTN SPPSSPSKSL NESVTLTSNK RIQFEHAPLP IMADTNPNLS QTNQQQTTLC  60
PIPRQTYGPS QIVNRFPSVM QGGDVTILDP ITGSNTNLVS HGARLKEPCL YESWTQGEHE  120
LFVKGLIKYG KGDWAKIAEE FVCNKTPQQV QSYAIIFFKN LQQSVSPPPP TYSYGYSSKN  180
PTYFAPYPMS RNLNPMVDPS ASNSMSMIVN QSQQLFTPVP MNVPFPLVPQ YGEASTSTNT  240
IAYGFQTHTS GATAGTSMHA IANDNKEIDL ELRLGRNN
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN38855.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028248131.10.0transcription factor KUA1-like
TrEMBLA0A445J3A00.0A0A445J3A0_GLYSO; Uncharacterized protein
STRINGGLYMA09G32895.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14942612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-12MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]