PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YC
Protein Properties Length: 247aa    MW: 28052.2 Da    PI: 10.667
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38779.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC301.1e-091472291799
       NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 k + +P+ ri+ ++k ++   ++s ea   + +a e f+ +++  ++  +   +++ l    +a +v++   +dfl d vp+ 
  KHN38779.1 147 KMNVFPMNRIRTMIKGEDPDMRVSQEALLAINNAVEKFLEQFSQEAYAFCVRDRKKCLSYDHLAHVVSKQRRYDFLSDFVPER 229
                 67789**********87666789*********************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.09E-15151227IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.4E-22151228IPR009072Histone-fold
PfamPF008083.0E-14151213IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0071897Biological ProcessDNA biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003887Molecular FunctionDNA-directed DNA polymerase activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MTSSNSPKPE KKITKNTEIS KTQKKKTKNA ETPKTEKKKT KNAETPKTEK KKTKNAETPK  60
TEKKKTKNAE TPKTEKKKNA EIPKIEKKKT KSAEIPLTDG KTKRDREIAK EENKKKTKKP  120
KLSNGTSKQR DEGSKKGVAE GKGEEGKMNV FPMNRIRTMI KGEDPDMRVS QEALLAINNA  180
VEKFLEQFSQ EAYAFCVRDR KKCLSYDHLA HVVSKQRRYD FLSDFVPERV KAEDALRERS  240
AAGTGGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939020.0BT093902.1 Soybean clone JCVI-FLGm-14G24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242442.11e-136uncharacterized protein LOC100793738
TrEMBLA0A0B2S3751e-176A0A0B2S375_GLYSO; DNA polymerase epsilon subunit C
STRINGGLYMA11G20740.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-26nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]