PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 174aa    MW: 19899.6 Da    PI: 8.2729
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37967.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13109154247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +rWT eE+ l++++ + +G+g+Wk I+++  k+Rt  q+  + qky
       KHN37967.1 109 KRWTNEEHRLFLEGLAYFGKGDWKNISKHAVKTRTKTQVTTHAQKY 154
                      69*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.408104159IPR017930Myb domain
SMARTSM007171.6E-6107157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-10109155IPR009057Homeodomain-like
PfamPF002491.3E-10109154IPR001005SANT/Myb domain
SuperFamilySSF466891.57E-16110160IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-13110157IPR006447Myb domain, plants
CDDcd001672.24E-8110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MLGFDDGDSD SDNEQALFGK YPELQMFKWE NSLIHLPSNL SSLLLPQTPL FHCEREETLR  60
VHPPPFLPLQ ETLDHLSANT APTQDITHLQ QARPANPPPT SSPSPNLCKR WTNEEHRLFL  120
EGLAYFGKGD WKNISKHAVK TRTKTQVTTH AQKYFLHIKE KGKGKRKSLF DMAL
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN37967.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028198046.11e-107uncharacterized protein LOC114382676
TrEMBLA0A0B2S1G91e-126A0A0B2S1G9_GLYSO; Transcription factor MYB1R1
STRINGGLYMA13G11174.11e-126(Glycine max)
STRINGGLYMA13G11187.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2019725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.12e-21MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]