PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37965.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 277aa    MW: 31165.3 Da    PI: 8.0524
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37965.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.43.2e-13109154247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +rWT eE+ l++++ + +G+g+Wk I+++  k+Rt  q+  + qky
       KHN37965.1 109 KRWTNEEHRLFLEGLAYFGKGDWKNISKHAVKTRTKTQVTTHAQKY 154
                      69*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.408104159IPR017930Myb domain
SMARTSM007171.6E-6107157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-10109155IPR009057Homeodomain-like
PfamPF002492.8E-10109154IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.4E-13110157IPR006447Myb domain, plants
SuperFamilySSF466893.59E-16110160IPR009057Homeodomain-like
CDDcd001671.17E-8110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MLGFDDGDSD SDNEQALFGK YPELQMFKWE NSLIHLPSNL SSLLLPQTPL FHCEREETLR  60
VHPPPFLPLQ ETLDHLSANT APTQDITHLQ QARPANPPPT SSPSPNLCKR WTNEEHRLFL  120
EGLAYFGKGD WKNISKHAVK TRTKTQVTTH AQKYFLHIKE KGKGKRKSLF DMAFASSFAG  180
NPRLCGAPLQ INCTGQSGNV HVSKQHGGSN DDVFETESLY LGMVVGFAAG LWWPRGSLFL  240
NKTWRHAYGF LNYVADEVHV LVPFKFNSFI GMQPSSL
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN37965.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028198046.11e-106uncharacterized protein LOC114382676
TrEMBLA0A0B2RY850.0A0A0B2RY85_GLYSO; Transcription factor MYB1R1
STRINGGLYMA13G11174.11e-124(Glycine max)
STRINGGLYMA13G11187.11e-124(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.15e-20MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]