PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37827.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 371aa    MW: 40704 Da    PI: 6.6805
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37827.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-32198253156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+++LH+rF++a++qLGG++ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  KHN37827.1 198 KQRRCWSQDLHKRFLHALQQLGGADTATPKQIREIMNVDGLTNDEVKSHLQKYRLH 253
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.487195255IPR017930Myb domain
SuperFamilySSF466896.81E-18196256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29196256IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-27198253IPR006447Myb domain, plants
PfamPF002496.7E-7200251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGFPDYIQTL EEERRKIQVF SKELPLSLEL VTQAIEACKQ QLSGTTSEYN LNGHSECSEQ  60
TTSTEGPVLE EFIPIKKMAS SSPFCDEEDE DDEQHSHKQR VSKENNNSDK RKSDWLRSVQ  120
LWNPDPPAEE DVNKKVPGLE LKRSGNGGGA FQPFHKEERG AKTSESLSKA PSSTSVAAAS  180
SSAAEPAAEK SLNEGQRKQR RCWSQDLHKR FLHALQQLGG ADTATPKQIR EIMNVDGLTN  240
DEVKSHLQKY RLHTRRPSPM VHNSSNPQAA PFVLVGNIFV QSPEYAAVAT STASREVATV  300
AAPAGIYAPV ATHPTPVSHP PADSIKNPQF KKVKLFEHSI SDERANHSEG AVHSNSPTSS  360
SSTHTSTSLG Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311960.0KT031196.1 Glycine max clone HN_CCL_161 MYB/HD-like transcription factor (Glyma10g34780.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536313.10.0PREDICTED: probable transcription factor GLK2
TrEMBLA0A0B2S1430.0A0A0B2S143_GLYSO; Two-component response regulator ARR18
STRINGGLYMA10G34780.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.17e-84G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]