PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37431.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 151aa    MW: 16935.9 Da    PI: 10.1582
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37431.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-143781347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN37431.1 37 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 81
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.9473086IPR017930Myb domain
SuperFamilySSF466891.73E-173287IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-173385IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-113480IPR009057Homeodomain-like
SMARTSM007177.3E-113484IPR001005SANT/Myb domain
PfamPF002492.9E-123781IPR001005SANT/Myb domain
CDDcd001671.38E-103782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MPLSGGAGIS TWDNANQISF GSKLKQQGEN ERKKGTPWTE EEHRLFLIGL SKFGKGDWRS  60
ISRNVVVTRT PTQVASHAQK YFLRQNSVKK ERKRSSIHDI TTVDSNSAPM PIDQTWVPPP  120
GGSVQQSQQY PSSNMHDQMG TFGYSNYGFD M
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}.
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN37431.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0830270.0AB083027.1 Glycine max mRNA for syringolide-induced protein 1-3-1A, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028184395.11e-109transcription factor DIVARICATA-like
SwissprotB8A9B22e-38MYBS1_ORYSI; Transcription factor MYBS1
SwissprotQ8LH592e-38MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBLA0A445ITS91e-108A0A445ITS9_GLYSO; Transcription factor SRM1
STRINGGLYMA10G42450.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-51MYB family protein
Publications ? help Back to Top
  1. Hong YF, et al.
    Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.
    Plant Cell, 2012. 24(7): p. 2857-73
    [PMID:22773748]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]