PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 270aa    MW: 30124 Da    PI: 10.2858
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37023.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.7e-15130174347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eE+ +++++ ++lG+g+W+ I++++ ++Rt+ q+ s+ qky
       KHN37023.1 130 PWNEEEHRKFLEGLEKLGKGNWRGISKHFVTTRTPSQVASHAQKY 174
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-12122175IPR009057Homeodomain-like
PROSITE profilePS5129420.03123179IPR017930Myb domain
SuperFamilySSF466891.64E-17124180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17126178IPR006447Myb domain, plants
SMARTSM007172.1E-12127177IPR001005SANT/Myb domain
PfamPF002493.8E-13130174IPR001005SANT/Myb domain
CDDcd001671.94E-10130175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MRTGRKCSYC RNFGHNSRTC NTHHKGGLKL FGVQLNLSNC RCCSSLSSTN SSSSSCSSTL  60
IDIMKRRSLS MNYHLVSSRI TSSSPSYNFL LGGGVDENSD KAISDGYIAS VGGGGLTSTT  120
RHQERKKGVP WNEEEHRKFL EGLEKLGKGN WRGISKHFVT TRTPSQVASH AQKYFLRQTS  180
FNKRKRRRSL FDVGRYETTT TLEPLNTCLK ASGQFGSLFG TIITCPQWVS YKHSVMNWAT  240
TSTNYTHQSA APDLELKLAV PKQTEPCERT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182187KRKRRR
2183187RKRRR
3183188RKRRRS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN37023.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028209085.10.0transcription factor MYBS3-like
TrEMBLA0A445GAQ70.0A0A445GAQ7_GLYSO; Transcription factor MYBS3
STRINGGLYMA17G34791.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3651522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.19e-40MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]