PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 308aa    MW: 34398.2 Da    PI: 6.5949
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37001.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.5e-20146200256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq  +Lee F+++++++ ++++eLA+kl+L  rqV vWFqNrRa+ k
  KHN37001.1 146 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTK 200
                 78889************************************************98 PP

2HD-ZIP_I/II119.22.3e-38146234189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+E+d+e Lk+++d+l+ en++L+ke +eL++
   KHN37001.1 146 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTKLKQTESDCELLKKCCDTLTVENKKLQKELQELKS 234
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-18141203IPR009057Homeodomain-like
PROSITE profilePS5007117.491142202IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-17144207IPR009057Homeodomain-like
SMARTSM003891.7E-15144206IPR001356Homeobox domain
CDDcd000867.63E-15145203No hitNo description
PfamPF000462.7E-17146200IPR001356Homeobox domain
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
SMARTSM003402.7E-16202245IPR003106Leucine zipper, homeobox-associated
PfamPF021834.4E-9202235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSFHDTSNTG LGLGLGLGLV SFHDQSGNCM KSTNNDPMRE SHKIKKVENP SSKCNNTYPS  60
LTLGPPDDDD DDDDEVNNNN QPSSKTESYE YFRPQVSSPS AVSSFSNSSS IKRERDQVLG  120
GEEFEVVVEK VPTRVVGDVD EDGNPRKKLR LTKEQAAVLE ENFREHSTLN PKQKQELAMK  180
LNLRARQVEV WFQNRRARTK LKQTESDCEL LKKCCDTLTV ENKKLQKELQ ELKSMQATPV  240
PLYMQIPAAT LSICPSCERI CGGNENNGDN NNNGSSHTTT LLIGSKTHHH SFYKSNNYPF  300
PHSSSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194202RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN37001.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0994120.0BT099412.1 Soybean clone JCVI-FLGm-13F4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028209552.11e-177homeobox-leucine zipper protein HAT9-like
SwissprotA2XE765e-64HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL45e-64HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A445GAQ31e-176A0A445GAQ3_GLYSO; Homeobox-leucine zipper protein HOX19
STRINGGLYMA0041S00350.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-49HD-ZIP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]