PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 369aa    MW: 41899.3 Da    PI: 7.8353
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36703.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-3293146255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  KHN36703.1  93 PRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRS 146
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.64889149IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-3089147IPR009057Homeodomain-like
SuperFamilySSF466891.29E-1491147IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2293148IPR006447Myb domain, plants
PfamPF002495.5E-994145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDETICVSEE DHHKSGSSSK PSSPTLRRKR SFFDLNEEAV DGGGDDSTSD DDGLMTSNGI  60
SSQEGNLSSN NSSSEEGKER ASTVRQYVRS KMPRLRWTPD LHLAFVHAVE RLGGQERATP  120
KLVLQLMNVK GLSIAHVKSH LQMYRSKKLD ESGQVLPHNR AMQGRHSIFD MYGRLNAPRH  180
FGNDNRNYLP SSLLLEQRPY ESGHGSSRLH PTALFNSHMI IRSSSGWDKD LYNYQYQRSF  240
CSPNFTGHAK FDAEAHDVKN RMPEFINQVQ IWKQGDIKDQ LERLNEKKGS PNFLELKLSQ  300
EYSRNVRDHQ MNKDSESEQE TITRLSLSLF TSSSSSNSSQ LAQGSEKQKD NTHVESFCFQ  360
NYAPRSHLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621440.10.0PREDICTED: putative two-component response regulator ARR21
TrEMBLA0A0B2RW850.0A0A0B2RW85_GLYSO; Putative Myb family transcription factor
STRINGGLYMA13G36616.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]